Metadata-Version: 2.1
Name: protenc
Version: 0.1.6
Summary: Extract protein embeddings from protein language models.
Home-page: https://github.com/kklemon/ProtEnc
Author: Kristian Klemon
Author-email: kristian.klemon@gmail.com
Requires-Python: >=3.10,<3.13
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Requires-Dist: biopython (>=1.81,<2.0)
Requires-Dist: humanfriendly (>=10.0,<11.0)
Requires-Dist: json-stream (>=2.3.2,<3.0.0)
Requires-Dist: lmdb (>=1.4.1,<2.0.0)
Requires-Dist: pandas (>=2.1.1,<3.0.0)
Requires-Dist: pytest (>=7.4.2,<8.0.0)
Requires-Dist: sentencepiece (>=0.1.99,<0.2.0)
Requires-Dist: tensordict (>=0.1.2,<0.2.0)
Requires-Dist: torch (>=2.0.1,<3.0.0)
Requires-Dist: tqdm (>=4.66.1,<5.0.0)
Requires-Dist: transformers (>=4.33.3,<5.0.0)
Project-URL: Repository, https://github.com/kklemon/ProtEnc
Description-Content-Type: text/markdown

ProtEnc: generate protein embeddings the easy way
=======

[ProtEnc](https://github.com/kklemon/ProtEnc) aims to simplify extraction of protein embeddings from various pre-trained models by providing simple APIs and bulk generation scripts for the ever-growing landscape of protein language models (pLMs). Currently, supported models are:

* [ProtTrans](https://github.com/agemagician/ProtTrans) family
* [ESM](https://github.com/facebookresearch/esm)
* AlphaFold (coming soon™)
* [OmegaPLM](https://www.biorxiv.org/content/10.1101/2022.07.21.500999v1) (coming soon™)

Usage
-----

### Installation

```bash
pip install protenc
```

### Python API

```python
import protenc

# List available models
print(protenc.list_models())

# Load encoder model
encoder = protenc.get_encoder('esm2_t30_150M_UR50D', device='cuda')

proteins = [
  'MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG',
  'KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE'
]

for embed in encoder(proteins, return_format='numpy'):
  # Embeddings have shape [L, D] where L is the sequence length and D the  embedding dimensionality.
  print(embed.shape)
  
  # Derive a single per-protein embedding vector by averaging along the sequence dimension
  embed.mean(0)
```

### Command-line interface

After installation, use the `protenc` shell command for bulk generation and export of protein embeddings.

```bash
protenc sequences.fasta embeddings.lmdb --model_name=<name-of-model>
```

By default, input and output formats are inferred from the file extensions.

Run

```bash
protenc --help
```

for a detailed usage description.

**Example**

Generate protein embeddings using the ESM2 650M model for sequences provided in a [FASTA](https://en.wikipedia.org/wiki/FASTA_format) file and write embeddings to an [LMDB](https://en.wikipedia.org/wiki/Lightning_Memory-Mapped_Database):

```bash
protenc proteins.fasta embeddings.lmdb --model_name=esm2_t33_650M_UR50D
```

The generated embeddings will be stored in a lmdb key-value store and can be easily accessed using the `read_from_lmdb` utility function:

```python
from protenc.utils import read_from_lmdb

for label, embed in read_from_lmdb('embeddings.lmdb'):
    print(label, embed)
```

**Features**

Input formats:
* CSV
* JSON
* [FASTA](https://en.wikipedia.org/wiki/FASTA_format)

Output format:
* [LMDB](https://en.wikipedia.org/wiki/Lightning_Memory-Mapped_Database)
* [HDF5](https://en.wikipedia.org/wiki/Hierarchical_Data_Format) (coming soon)

General:
* Multi-GPU inference with (`--data_parallel`)
* FP16 inference (`--amp`)

Development
-----------

Clone the repository:

```bash
git clone git+https://github.com/kklemon/protenc.git
```

Install dependencies via [Poetry](https://python-poetry.org/):

```bash
poetry install
```

Contribution
------------

Have feature ideas or found a bug? Love to see support for a new model? Feel free to [create an issue](https://github.com/kklemon/ProtEnc/issues/new).

Todo
----

- [ ] Support for more input formats
  - [X] CSV
  - [ ] Parquet
  - [X] FASTA
  - [X] JSON
- [ ] Support for more output formats
  - [X] LMDB
  - [ ] HDF5
  - [ ] DataFrame
  - [ ] Pickle
- [ ] Support for large models
  - [ ] Model offloading
  - [ ] Sharding
  - [ ] FlashAttention (via Kernl?)
- [ ] Support for more protein language models
  - [X] Whole ProtTrans family
  - [X] Whole ESM family
  - [ ] AlphaFold (?)
- [X] Implement all remaining TODOs in code
- [ ] Evaluation
- [ ] Demos
- [ ] Distributed inference
- [ ] Maybe support some sort of optimized inference such as quantization
  - This may be up to the model providers
- [ ] Improve documentation
- [ ] Support translation of gene sequences
- [ ] Add tests. We need tests!!!

