Metadata-Version: 2.1
Name: phamclust
Version: 1.0.1
Summary: Cluster genomes based on gene phamily data
Home-page: https://github.com/chg60/phamclust
Author: Christian Gauthier
Author-email: chg60@pitt.edu
Project-URL: Source, https://github.com/chg60/phamclust
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: GNU General Public License v3 (GPLv3)
Classifier: Operating System :: MacOS
Classifier: Operating System :: POSIX :: Linux
Classifier: Programming Language :: Python
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3 :: Only
Classifier: Programming Language :: Python :: 3.6
Classifier: Programming Language :: Python :: 3.7
Classifier: Programming Language :: Python :: 3.8
Classifier: Programming Language :: Python :: 3.9
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Requires-Python: >=3.6
Description-Content-Type: text/markdown
License-File: LICENSE

# phamclust

PhamClust is a tool for performing gene phamily based clustering of bacteriophage genomes. It makes use of a novel genome similarity index, the proteomic equivalence quotient (PEQ) to cluster genomes according to their global similarity. A manuscript describing it in detail has been submitted for publication at mSphere.

# Installation

The most straightforward way to install PhamClust is from the Python Package Index (PyPI): `pip install phamclust`

# Usage

Once installed, invoking `phamclust` at the commandline with no arguments will display the help menu:

```
(phamclust) chg60 % phamclust
usage: phamclust [-h] [-g] [-k] [-s] [-sl] [-c] [-cl] [-nr] [-nl] [-m] [-d] [-n] [-r] [-t] infile outdir

Cluster phage genomes using gene content similarity-based metrics.

positional arguments:
  infile                path to a TSV file mapping genomes to phams and translations
  outdir                path to which output files should be written

options:
  -h, --help            show this help message and exit
  -g, --genome-dir      interpret `infile` as a directory of genome FASTA files instead of TSV
  -d, --debug           increase verbosity of logging for debug purposes
  -n, --no-sub          do not perform sub-clustering
  -r, --remove-tmp      remove temporary files (not recommended if repeated runs are planned on the same dataset)
  -t , --threads        number of CPU cores to use [default: 16]

clustering arguments::
  -k , --k-min          minimum cluster size to perform subclustering [default: 6]
  -s , --sub-thresh     similarity threshold to use for sub-clustering [default: 0.6]
  -sl , --sub-linkage   linkage type to use for sub-clustering [default: single]
  -c , --clu-thresh     similarity threshold to use for clustering [default: 0.25]
  -cl , --clu-linkage   linkage type to use for clustering [default: average]
  -nr , --nr-thresh     similarity threshold above which to pre-group very similar genomes that must be clustered together [default: 0.75]
  -nl , --nr-linkage    linkage type to use for pre-grouping very similar genomes [default: complete]
  -m , --metric         relatedness index to use for pairwise genome comparisons [default: peq]

Available metrics:

    Acronym     Name                                Reference
(1) gcs         gene content similarity             https://doi.org/10.1038/nmicrobiol.2017.112
(2) jc          jaccard coefficient                 https://doi.org/10.1111/j.1469-8137.1912.tb05611.x
(3) pocp        percentage of conserved proteins    https://doi.org/10.1128/JB.01688-14
(4) af          alignment fraction                  https://doi.org/10.1093/nar/gkv657
(5) aai         average aminoacid identity          https://doi.org/10.1073/pnas.0409727102
(6) peq         proteomic equivalence quotient      Gauthier & Hatfull, 2023
```

PhamClust takes an input filepath and an output filepath as its primary arguments. By default, the input path is assumed to be a TSV file mapping genome names/identifiers to pham identifiers and translations.

If the `-g/--genome-dir` argument is provided, PhamClust interprets the input filepath as a directory containing one FASTA file per genome, with headers structured as in the example below:

```
>name=Bipper|pham=pham_1|n=1
MTAPLLQSVTADDGNMITVPTLQFTRWLDETRDKVIGADGAPDPVRDPMSAYRYLKGRRSVIEGAARQRPMLRLFDKNMDPIAQIAGERLASVEEMMSDSGQANVVLRYDNWLTDFILHQTKIHEDLHLVVDPNPTNRTWRTRWGGKITGINAKRDSSGIHTLELEAISNRQHAKHMLFASNPVFPPEIQLPKMWVLPGNTRTILSISMFVNLARRFFPLLSIPTNIFNPMAWVNGWGAGLDPLMWPLQVAFVNPLLDQSRLSVLGSSWTDWHTAMDSMLKDAGVLFRAYTWLTEDADTPHTELVDMVRGLGPLQDTVDNLTRPHRNCVVFALEDKSGVQGPTGTAADGVINLIGATADDMITETLFNLDRDGDGETDPIFRKLLGVAPEKPKTIWYDGQFSGIIESEIRRHKGPVKKIHTGGRSPSILNQAQTYAIRYALSQLAQVISYGIGAYQQYGTEGLDNLYQGQLDNTLFAWQAFDDPIRALQTGDMAWQEHFERGSGTAYTLSGIVTLRVGHYKTRAWQGFTVKVVNGRPHAVDVDITLGDRAGFEQGGIIFVDQITAIKRSWSRTEPVTVQLSIGDDQDKEDPAARGLRAIQAVWTTLGMLLGEGTIF
>name=Bipper|pham=pham_37|n=1
MTSPSGVAVAALKGHTKPRLYTPPLAVNCNIWIAPELSCPCGCGLHAGTSWGFDCIDFLTNVLKWQLIPYQRWLYIHALEKGPGGEGFRFKTLVILIARQNGKTQWLRGLGLWRLYLDSRGRSSPDCPAAKTVVIAAQGLEYAEGTLGEVVNDVKECRALKREFLRHRQTNGKHAMLLSGRRSWRAVAANRKGGRSMSVDLAELDELREHHDWLAWNAITPTTQARQYSQNVAASNAGDKRSVVLRSLRDGAMAKILARDTEDTKTGLFEYSAPQDANPLERKYWPMANPALGYLPGHDEDALAAKAEAMADNMAGFVTEHLCQWVDTLLPGVMPMEDWNATTDPESRRAEGAPVYAAVDVSHSRSKAYIAVASRRSDGLLHVEVVAAHRGTDWVVPWFKARPGKFVAVAVQARGCPASDLIEPLTEAGVPVMELGGAELVRGAGGVLFDGIRKHAIWHRPSPALDTAAKGTVSRSLGGDTWVLDRKNSPVDAAPLVACAAAAWAEGQGPMVPDKVPEVHEWPDEEEIAEWEKELDELQ
...
```

If a genome encodes more than one copy of a pham (namely, paralogs), each copy after the first should increment the value of `n`.

Six metrics are available for calculating intergenomic similarities (single-CPU processing speeds estimated in parentheses): 

1. Gene Content Similarity (gcs)                    (>100,000 pairs/second)
2. Jaccard Coefficient (jc)                         (>55,000 pairs/second)
3. Percentage of Conserved Proteins (pocp)          (>25,000 pairs/second)
4. Alignment Fraction (AF)                          (>15,000 pairs/second)
5. Average Aminoacid Identity (aai)                 (~500 pairs/second)
6. Proteomic Equivalence Quotient (peq)             (~475 pairs/second)

Because of how cheap the first four metrics are, the maximum parallelization benefit is seen with just 4 CPU cores for datasets consisting of fewer than 2,500 genomes. The last two metrics are considerably more expensive to calculate, and will see benefit from as many physical cores are available on your machine (i.e., core count, not thread count). 
