Metadata-Version: 2.1
Name: mhcflurry
Version: 2.0.5
Summary: MHC Binding Predictor
Home-page: https://github.com/openvax/mhcflurry
Author: Tim O'Donnell and Alex Rubinsteyn
Author-email: timodonnell@gmail.com
License: http://www.apache.org/licenses/LICENSE-2.0.html
Description: [![Build Status](https://app.travis-ci.com/openvax/mhcflurry.svg?branch=master)](https://app.travis-ci.com/openvax/mhcflurry)
        
        # mhcflurry
        [MHC I](https://en.wikipedia.org/wiki/MHC_class_I) ligand
        prediction package with competitive accuracy and a fast and 
        [documented](http://openvax.github.io/mhcflurry/) implementation.
        
        MHCflurry implements class I peptide/MHC binding affinity prediction. 
        The current version provides pan-MHC I predictors supporting any MHC
        allele of known sequence. MHCflurry runs on Python 3.4+ using the
        [tensorflow](https://www.tensorflow.org/) neural network library.
        It exposes [command-line](http://openvax.github.io/mhcflurry/commandline_tutorial.html)
        and [Python library](http://openvax.github.io/mhcflurry/python_tutorial.html)
        interfaces.
        
        Starting in version 1.6.0, MHCflurry also includes two expermental predictors,
        an "antigen processing" predictor that attempts to model MHC allele-independent
        effects such as proteosomal cleavage and a "presentation" predictor that
        integrates processing predictions with binding affinity predictions to give a
        composite "presentation score." Both models are trained on mass spec-identified
        MHC ligands. These models were updated to incorporate minor improvements
        for the MHCflurry 2.0 release.
        
        If you find MHCflurry useful in your research please cite:
        
        > T. O'Donnell, A. Rubinsteyn, U. Laserson. "MHCflurry 2.0: Improved pan-allele prediction of MHC I-presented peptides by incorporating antigen processing," *Cell Systems*, 2020. https://doi.org/10.1016/j.cels.2020.06.010
        
        > T. O’Donnell, A. Rubinsteyn, M. Bonsack, A. B. Riemer, U. Laserson, and J. Hammerbacher, "MHCflurry: Open-Source Class I MHC Binding Affinity Prediction," *Cell Systems*, 2018. https://doi.org/10.1016/j.cels.2018.05.014
        
        Please file an issue if you have questions or encounter problems.
        
        Have a bugfix or other contribution? We would love your help. See our [contributing guidelines](CONTRIBUTING.md).
        
        ## Installation (pip)
        
        Install the package:
        
        ```
        $ pip install mhcflurry
        ```
        
        Then download our datasets and trained models:
        
        ```
        $ mhcflurry-downloads fetch
        ```
        
        You can now generate predictions:
        
        ```
        $ mhcflurry-predict \
               --alleles HLA-A0201 HLA-A0301 \
               --peptides SIINFEKL SIINFEKD SIINFEKQ \
               --out /tmp/predictions.csv
               
        Wrote: /tmp/predictions.csv
        ```
        
        Or scan protein sequences for potential epitopes:
        
        ```
        $ mhcflurry-predict-scan \
                --sequences MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS \
                --alleles HLA-A*02:01 \
                --out /tmp/predictions.csv
                
        Wrote: /tmp/predictions.csv  
        ```
        
        
        See the [documentation](http://openvax.github.io/mhcflurry/) for more details.
        
        
        ## Docker
        You can also try the latest (GitHub master) version of MHCflurry using the Docker
        image hosted on [Dockerhub](https://hub.docker.com/r/openvax/mhcflurry) by
        running:
        
        ```
        $ docker run -p 9999:9999 --rm openvax/mhcflurry:latest
        ``` 
        
        This will start a [jupyter](https://jupyter.org/) notebook server in an
        environment that has MHCflurry installed. Go to `http://localhost:9999` in a
        browser to use it.
        
        To build the Docker image yourself, from a checkout run:
        
        ```
        $ docker build -t mhcflurry:latest .
        $ docker run -p 9999:9999 --rm mhcflurry:latest
        ```
        ## Predicted sequence motifs
        Sequence logos for the binding motifs learned by MHCflurry BA are available [here](https://openvax.github.io/mhcflurry-motifs/).
        
        ## Common issues and fixes
        
        ### Problems downloading data and models
        Some users have reported HTTP connection issues when using `mhcflurry-downloads fetch`. As a workaround, you can download the data manually (e.g. using `wget`) and then use `mhcflurry-downloads` just to copy the data to the right place.
        
        To do this, first get the URL(s) of the downloads you need using `mhcflurry-downloads url`:
        
        ```
        $ mhcflurry-downloads url models_class1_presentation
        https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
        ```
        
        Then make a directory and download the needed files to this directory:
        
        ```
        $ mkdir downloads
        $ wget  --directory-prefix downloads https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
        
        HTTP request sent, awaiting response... 200 OK
        Length: 72616448 (69M) [application/octet-stream]
        Saving to: 'downloads/models_class1_presentation.20200205.tar.bz2'
        ```
        
        Now call `mhcflurry-downloads fetch` with the `--already-downloaded-dir` option to indicate that the downloads should be retrived from the specified directory:
        
        ```
        $ mhcflurry-downloads fetch models_class1_presentation --already-downloaded-dir downloads
        ```
        
        
        
Platform: UNKNOWN
Classifier: Development Status :: 5 - Production/Stable
Classifier: Environment :: Console
Classifier: Operating System :: OS Independent
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Programming Language :: Python
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Description-Content-Type: text/markdown
