Metadata-Version: 1.1
Name: isovar
Version: 0.5.2
Summary: Assemble transcript sequences fragments near variants
Home-page: https://github.com/hammerlab/isovar
Author: Alex Rubinsteyn and Arman Aksoy
Author-email: alex {dot} rubinsteyn {at} mssm {dot} edu
License: http://www.apache.org/licenses/LICENSE-2.0.html
Description: |DOI| |Build Status| |Coverage Status|
        
        isovar
        ======
        
        Isovar assembles protein subsequences around mutations from cancer
        RNA-Seq data. Since Isovar uses sequenced reads to determine a mutant
        coding sequence it is able to correctly phase somatic variants with
        adjacent germline variants, as well as sometimes recovering
        alternatively spliced isoforms.
        
        Example
        -------
        
        .. code:: sh
        
            $ isovar-protein-sequences.py  \
                --vcf somatic-variants.vcf  \
                --bam rnaseq.bam \
                --min-reads 2 \
                --protein-sequence-length 30 \
                --output isovar-results.csv
        
              chr       pos ref alt                      amino_acids  \
            0  22  46931060   A   C   FGVEAVDHGWPSMSSGSSWRASRGPPPPPR
        
               variant_aa_interval_start  variant_aa_interval_end ends_with_stop_codon  \
            0                         16                       17                False
        
              frameshift  translations_count  supporting_variant_reads_count  \
            0      False                   1                               1
        
               total_variant_reads  supporting_transcripts_count  total_transcripts     gene
            0                  130                             2                  2   CELSR1
        
        Algorithm/Design
        ----------------
        
        The one line explanation of Isovar:
        ``ProteinSequence = VariantSequence + ReferenceContext``.
        
        A little more detail about the algorithm: 1. Scan through an RNAseq BAM
        file and extract sequences overlapping a variant locus (represented by
        ``LocusRead``) 2. Make sure that the read contains the variant allele
        and split its sequence into prefix/alt/suffix string parts (represented
        by ``AlleleRead``) 3. Assemble overlapping ``AlleleRead``\ s (which
        agree with the variant allele) into a ``VariantSequence`` 4. Gather
        possible reading frames for distinct reference sequences around the
        variant locus (represented by ``ReferenceContext``). 5. Use the reading
        frame from a ``ReferenceContext`` to translate a ``VariantSequence``
        into a protein fragment (represented by ``Translation``). 6. Multiple
        distinct variant sequences and reference contexts can generate the same
        translations, so we aggregate those equivalent ``Translation`` objects
        into a ``ProteinSequence``.
        
        Since we may not want to deal with *every* possible translation of
        *every* distinct sequence detected around a variant, Isovar sorts the
        variant sequences by the number of supporting reads and the reference
        contexts in order of protein length and a configurable number of
        translated protein fragments can be kept from this ordering.
        
        Sequencing Recommendations
        --------------------------
        
        Isovar works best with high quality / high coverage mRNA sequence data.
        This means that you will get best results from >100M paired-end reads
        sequenced on an Illumina HiSeq from a library enriched with poly-A
        capture. The number of reads varies depending on degree of RNA
        degradation and tumor purity. The read length will determine the longest
        protein sequence you can recover, since Isovar's cDNA assembly only
        considers reads that overlap a variant. With 100bp reads you will be
        able to assemble at most 199bp of sequence around a somatic single
        nucleotide variant, and consequently only be to determine 66 amino acids
        from the protein sequence. If you disable the cDNA assembly algorithm
        then a 100bp read will only be able to determine 33 amino acids.
        
        .. |DOI| image:: https://zenodo.org/badge/18834/hammerlab/isovar.svg
           :target: https://zenodo.org/badge/latestdoi/18834/hammerlab/isovar
        .. |Build Status| image:: https://travis-ci.org/hammerlab/isovar.svg?branch=master
           :target: https://travis-ci.org/hammerlab/isovar
        .. |Coverage Status| image:: https://coveralls.io/repos/github/hammerlab/isovar/badge.svg?branch=master
           :target: https://coveralls.io/github/hammerlab/isovar?branch=master
        
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Environment :: Console
Classifier: Operating System :: OS Independent
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Programming Language :: Python
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
