Metadata-Version: 1.1
Name: isovar
Version: 0.0.5
Summary: Assemble transcript sequences fragments near variants
Home-page: https://github.com/hammerlab/isovar
Author: Alex Rubinsteyn and Arman Aksoy
Author-email: alex {dot} rubinsteyn {at} mssm {dot} edu
License: http://www.apache.org/licenses/LICENSE-2.0.html
Description: |DOI| |Build Status| |Coverage Status|
        
        isovar
        ======
        
        Abundance quantification of distinct transcript sequences containing
        somatic variants from cancer RNAseq
        
        Example
        -------
        
        .. code:: sh
        
            $ isovar-protein-sequences.py  \
                --vcf somatic-variants.vcf  \
                --bam rnaseq.bam \
                --genome hg19 \
                --min-reads 2 \
                --protein-sequence-length 30 \
                --output isovar-results.csv
        
              chr       pos ref alt                      amino_acids  \
            0  22  46931060   A   C   FGVEAVDHGWPSMSSGSSWRASRGPPPPPR
            1  22  46931062   G   A  CFGVEAVDHGWPPMSLAHGGPAVVHRLHPEA
        
               variant_aa_interval_start  variant_aa_interval_end ends_with_stop_codon  \
            0                         16                       17                False
            1                         16                       17                False
        
              frameshift  translations_count  supporting_variant_reads_count  \
            0      False                   1                               1
            1      False                   1                               1
        
               total_variant_reads  supporting_transcripts_count  total_transcripts  \
            0                  130                             2                  2
            1                  127                             2                  2
        
                 gene
            0  CELSR1
            1  CELSR1
        
        Algorithm/Design
        ----------------
        
        The one line explanation of isovar:
        ``ProteinSequence = VariantSequence + ReferenceContext``.
        
        A little more detail about the algorithm: 1. Scan through an RNAseq BAM
        file and extract sequences overlapping a variant locus (represented by
        ``ReadAtLocus``) 2. Make sure that the read contains the variant allele
        and split its sequence into prefix/alt/suffix string parts (represented
        by ``VariantRead``) 3. Combine multiple ``VariantRead`` records into a
        ``VariantSequence`` 4. Gather possible reading frames for distinct
        reference sequences around the variant locus (represented by
        ``ReferenceContext``). 5. Use the reading frame from a
        ``ReferenceContext`` to translate a ``VariantSequence`` into a protein
        fragment (represented by ``Translation``). 6. Multiple distinct variant
        sequences and reference contexts can generate the same translations, so
        we aggregate those equivalent ``Translation`` objects into a
        ``ProteinSequence``.
        
        Since we may not want to deal with *every* possible translation of
        *every* distinct sequence detected around a variant, ``isovar`` sorts
        the variant sequences by the number of supporting reads and the
        reference contexts in order of protein length and a configurable number
        of translated protein fragments can be kept from this ordering.
        
        .. |DOI| image:: https://zenodo.org/badge/18834/hammerlab/isovar.svg
           :target: https://zenodo.org/badge/latestdoi/18834/hammerlab/isovar
        .. |Build Status| image:: https://travis-ci.org/hammerlab/isovar.svg?branch=master
           :target: https://travis-ci.org/hammerlab/isovar
        .. |Coverage Status| image:: https://coveralls.io/repos/github/hammerlab/isovar/badge.svg?branch=master
           :target: https://coveralls.io/github/hammerlab/isovar?branch=master
        
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Environment :: Console
Classifier: Operating System :: OS Independent
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Programming Language :: Python
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
