Metadata-Version: 2.1
Name: bio-transformers
Version: 0.0.2
Summary: Wrapper on top of ESM/Protbert model in order to easily work with protein embedding
Home-page: UNKNOWN
Author: Instadeep
Author-email: a.delfosse@instadeep.com
License: Apache-2.0
Platform: UNKNOWN
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3.7
Classifier: Topic :: Scientific/Engineering :: Artificial Intelligence
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Software Development
Requires-Python: >=3.7
Description-Content-Type: text/markdown
Requires-Dist: numpy (>=1.16)
Requires-Dist: torch (==1.5.0)
Requires-Dist: fair-esm (==0.3.1)
Requires-Dist: pandas (>=1.2.3)
Requires-Dist: tqdm (>=4.60.0)
Requires-Dist: transformers (==4.5.1)

<p align="center">
  <img width="50%" src="./.source/_static/deepchain.png">
</p>


# Description
bio-transformers is a wrapper on top of the ESM/Protbert model, trained on millions on proteins and used to predict embeddings.
This package provide other functionalities (like compute the loglikelihood of a protein) or compute embeddings on multiple-gpu.

## Installation
It is recommended to work with conda environnements in order to manage the specific dependencies of the package.
```bash
  conda create --name bio-transformers python=3.7 -y 
  conda activate bio-transformers
  pip install bio-transformers
```

# How it works
The main class ```BioTranformers``` allow the developper to use Protbert and ESM backend

```
from biotransformers import BioTransformers
BioTransformers.list_backend()
```

## Embeddings
Choose a backend and pass a list of sequences of Amino acids to compute the embeddings.
By default, the ```compute_embeddings``` function return the ```<CLS>``` token embedding.
You can add a ```pooling_list``` in addition , so you can compute the mean of the tokens embeddings.

```
from biotransformers import BioTransformers

sequences = [
        "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
        "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
    ]

bio_trans = BioTransformers(model_dir="Rostlab/prot_bert")
embeddings = bio_trans.compute_embeddings(sequences, pooling_list=['mean'])

cls_emb = embeddings['cls']
mean_emb = embeddings['mean']
```

## Loglikelihood
Choose a backend and pass a list of sequences of Amino acids to compute the Loglikelihood.

```
from biotransformers import BioTransformers

sequences = [
        "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
        "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
    ]

bio_trans = BioTransformers(model_dir="Rostlab/prot_bert")
loglikelihood = bio_trans.compute_loglikelihood(sequences)
```

